PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000164048
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 217aa    MW: 25168.4 Da    PI: 9.1061
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000164048genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l+d+ + +G+g+W++I++  g++R +k+c++rw++yl
    MDP0000164048  9 KGLWTKEEDEILLDYKRVHGSGRWNRIPKVTGLKRNGKSCRLRWLNYL 56
                     678*****************************9*************97 PP

2Myb_DNA-binding53.84.6e-1762106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++++E++l+++++++lG++ W++Ia +++ gRt++q+k++w+ +
    MDP0000164048  62 RGDFSEQEEDLIIRLHNLLGNR-WSLIAGRLP-GRTDNQVKNYWNAH 106
                      899*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.244156IPR017930Myb domain
SuperFamilySSF466891.21E-297103IPR009057Homeodomain-like
SMARTSM007172.6E-13858IPR001005SANT/Myb domain
PfamPF002499.5E-15956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-221063IPR009057Homeodomain-like
CDDcd001672.65E-101256No hitNo description
PROSITE profilePS5129426.02757111IPR017930Myb domain
SMARTSM007171.6E-1661109IPR001005SANT/Myb domain
PfamPF002494.8E-1662107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-2564111IPR009057Homeodomain-like
CDDcd001675.78E-1165107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEAEYEYKKG LWTKEEDEIL LDYKRVHGSG RWNRIPKVTG LKRNGKSCRL RWLNYLSPDV  60
KRGDFSEQEE DLIIRLHNLL GNRWSLIAGR LPGRTDNQVK NYWNAHLSKK LGDIKKQHTP  120
RKFVVSTSKA HSCATQELPG DKLVHQHKLL KARDSDSTSG MKSNNQTANL DSNEEEKIEW  180
MAKHCTESLS CSNYDNLISW GMVNILQGYP LDYCNYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-27611124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340025.11e-162PREDICTED: transcription factor WER-like
SwissprotQ9SEI04e-62WER_ARATH; Transcription factor WER
TrEMBLM5XZK02e-88M5XZK0_PRUPE; Uncharacterized protein
STRINGVIT_01s0127g00730.t015e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-63myb domain protein 66